Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM161B Rabbit Polyclonal Antibody (HRP)

TMEM161B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLB3342, PRO1313

UniProt

Q8NDZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM161B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699185

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Sophora japonica (Pagoda Tree) -SJA-
R-2901-2 2 mg

TRITC Conjugated Sophora japonica (Pagoda Tree) -SJA-

Sign In for Pricing
View Details
Prmt3 Mouse Gene Knockout Kit (CRISPR)
KN513936 1 Kit

Prmt3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/836), Biotin conjugate, 0.1mg/mL
BNCB0836-500 1x 500 µL

Cytokeratin 18 (KRT18/836), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-32] - BSA and Azide free (Detector)
HA722261 100 µL

Human Adiponectin Recombinant Rabbit Monoclonal Antibody [PSH05-32] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
1700025G04Rik (NM_197990) Mouse Tagged ORF Clone
MG200588 10 µg

1700025G04Rik (NM_197990) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human DDX60L activation kit by CRISPRa
GA114104 1 Kit

Human DDX60L activation kit by CRISPRa

Sign In for Pricing
View Details