Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIM1K Rabbit Polyclonal Antibody (HRP)

NIM1K Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NIM1

UniProt

Q8IY84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MGC42105

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF405S conjugate, 0.1mg/mL
BNC041869-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (rDG1/447), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EIF4EBP1 pThr45 Rabbit Polyclonal Antibody
AP20918PU-N 100 µg

EIF4EBP1 pThr45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Serine Palmitoyltransferase (SPTLC2) (C-term) Rabbit Polyclonal Antibody
AP12257PU-N 400 µL

Serine Palmitoyltransferase (SPTLC2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,2,2-Trifluoroethyl perfluorobutanesulphonate
TRC-T790575-5G 5 g

2,2,2-Trifluoroethyl perfluorobutanesulphonate

Sign In for Pricing
View Details
Human Cluster Of Differentiation 83 (CD83) ELISA Kit
RDR-CD83-Hu-01 96 Tests

Human Cluster Of Differentiation 83 (CD83) ELISA Kit

Sign In for Pricing
View Details
Human Cluster Of Differentiation 83 (CD83) ELISA Kit
RDR-CD83-Hu-02 48 Tests

Human Cluster Of Differentiation 83 (CD83) ELISA Kit

Sign In for Pricing
View Details