Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS35 Rabbit Polyclonal Antibody (Biotin)

PRSS35 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C6orf158, dJ223E3.1

UniProt

Q8N3Z0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS35

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (4- (trifluoromethyl) phenyl) -1h-pyrazole-5-carboxylic acid
NRB39868-01 0.5 g

3- (4- (trifluoromethyl) phenyl) -1h-pyrazole-5-carboxylic acid

Sign In for Pricing
View Details
3- (4- (trifluoromethyl) phenyl) -1h-pyrazole-5-carboxylic acid
NRB39868-02 5 g

3- (4- (trifluoromethyl) phenyl) -1h-pyrazole-5-carboxylic acid

Sign In for Pricing
View Details
PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (MaxLight 490)
MBS6207872-01 0.1 mL

PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (MaxLight 490)

Sign In for Pricing
View Details
PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (MaxLight 490)
MBS6207872-02 5x 0.1 mL

PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (MaxLight 490)

Sign In for Pricing
View Details
Anti-MOT1 SLC16A1 Antibody
A02240 100 µL

Anti-MOT1 SLC16A1 Antibody

Sign In for Pricing
View Details
Ccdc23 3'UTR Luciferase Stable Cell Line
TU201784 1.0 mL

Ccdc23 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details