Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS35 Rabbit Polyclonal Antibody (HRP)

PRSS35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C6orf158, dJ223E3.1

UniProt

Q8N3Z0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Kluyveromyces lactis ATP synthase subunit a (ATP6), partial
MBS7085514 Inquire

Recombinant Kluyveromyces lactis ATP synthase subunit a (ATP6), partial

Sign In for Pricing
View Details
Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit
MBS9347787-01 48 Well

Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit

Sign In for Pricing
View Details
Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit
MBS9347787-02 96 Well

Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit

Sign In for Pricing
View Details
Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit
MBS9347787-03 5x 96 Well

Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit

Sign In for Pricing
View Details
Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit
MBS9347787-04 10x 96 Well

Human Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit

Sign In for Pricing
View Details
Sulfo-Cyanine3 azide, 25 mg
D1330 25 mg

Sulfo-Cyanine3 azide, 25 mg

Sign In for Pricing
View Details