Prss35 Rabbit Polyclonal Antibody (HRP)
Prss35 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
P3D9, 6030424L22Rik
UniProt
Q8C0F9
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Prss35
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: HDGKDYVKGSKKLRVGVLKMRNKGGRKKRRGSKRSRREAESAGQSQAHLR
Purification
Affinity Purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
45kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Applications
WB
NCBI Accession Number
NP_848853
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS438062-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
Mitochondria (Marker for Human Cells, Granular RCC & Salivary Tumors) Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438062-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
Mitochondria (Marker for Human Cells, Granular RCC & Salivary Tumors) Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438062-03 0.1 mg (Without BSA & Azide at 1mg/mL)
Mitochondria (Marker for Human Cells, Granular RCC & Salivary Tumors) Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438062-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)
Mitochondria (Marker for Human Cells, Granular RCC & Salivary Tumors) Mouse Monoclonal Antibody
Sign In for Pricing
View Details MBS438062-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)
Mitochondria (Marker for Human Cells, Granular RCC & Salivary Tumors) Mouse Monoclonal Antibody
Sign In for Pricing
View Details 
orb3127860 100 µg
SGOL1/SGO1 Rabbit Polyclonal Antibody (Fluoro647)
Sign In for Pricing
View Details