Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP3K7IP1 Rabbit Polyclonal Antibody (FITC)

MAP3K7IP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

3'-Tab1, MAP3K7IP1

UniProt

Q8IZW2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K7IP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_705717

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (MaxLight 650)
244231-ML650 100 µL

CARF (CDKN2A Interacting Protein, CARF, FLJ20036) (MaxLight 650)

Sign In for Pricing
View Details
Human CD10 ELISA Kit
CEK1051 96 Tests

Human CD10 ELISA Kit

Sign In for Pricing
View Details
DMOG (N- (2-Methoxy-2-oxoacetyl) glycine methyl ester) discontinued. See 255173
169956-01 5 mg

DMOG (N- (2-Methoxy-2-oxoacetyl) glycine methyl ester) discontinued. See 255173

Sign In for Pricing
View Details
DMOG (N- (2-Methoxy-2-oxoacetyl) glycine methyl ester) discontinued. See 255173
169956-02 25 mg

DMOG (N- (2-Methoxy-2-oxoacetyl) glycine methyl ester) discontinued. See 255173

Sign In for Pricing
View Details
Human Mitochondrial Open Reading Frame Of The 12S rRNA-c (MOTS-c) ELISA Kit
SL4810Hu-01 48 Tests

Human Mitochondrial Open Reading Frame Of The 12S rRNA-c (MOTS-c) ELISA Kit

Sign In for Pricing
View Details
Human Mitochondrial Open Reading Frame Of The 12S rRNA-c (MOTS-c) ELISA Kit
SL4810Hu-02 96 Tests

Human Mitochondrial Open Reading Frame Of The 12S rRNA-c (MOTS-c) ELISA Kit

Sign In for Pricing
View Details