Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP3K7IP1 Rabbit Polyclonal Antibody (HRP)

MAP3K7IP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

3'-Tab1, MAP3K7IP1

UniProt

Q8IZW2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K7IP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_705717

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCP1A Rabbit Polyclonal Antibody
orb1175266 100 µg

DCP1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PTPRZ1 full length protein-synthetic nanodisc
orb2950034-01 10 µg

Human PTPRZ1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human PTPRZ1 full length protein-synthetic nanodisc
orb2950034-02 50 µg

Human PTPRZ1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human PTPRZ1 full length protein-synthetic nanodisc
orb2950034-03 100 µg

Human PTPRZ1 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human PGC Ready-To-Use IHC Kit
orb1974413 50 Tests

Human PGC Ready-To-Use IHC Kit

Sign In for Pricing
View Details
KCTD16 (NM_020768) Human Recombinant Protein
PROTQ68DU8 20 µg

KCTD16 (NM_020768) Human Recombinant Protein

Sign In for Pricing
View Details