Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE9 Rabbit Polyclonal Antibody (Biotin)

CPNE9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KIAA4217

UniProt

Q8IYJ1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CPNE9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_705899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMBIM4, NT (TMBIM4, GAAP, LFG4, Protein lifeguard 4, Golgi anti-apoptotic protein, Protein S1R, Transmembrane BAX inhibitor motif-containing protein 4, Z-protein) (Biotin)
MBS6356121-01 0.2 mL

TMBIM4, NT (TMBIM4, GAAP, LFG4, Protein lifeguard 4, Golgi anti-apoptotic protein, Protein S1R, Transmembrane BAX inhibitor motif-containing protein 4, Z-protein) (Biotin)

Sign In for Pricing
View Details
TMBIM4, NT (TMBIM4, GAAP, LFG4, Protein lifeguard 4, Golgi anti-apoptotic protein, Protein S1R, Transmembrane BAX inhibitor motif-containing protein 4, Z-protein) (Biotin)
MBS6356121-02 5x 0.2 mL

TMBIM4, NT (TMBIM4, GAAP, LFG4, Protein lifeguard 4, Golgi anti-apoptotic protein, Protein S1R, Transmembrane BAX inhibitor motif-containing protein 4, Z-protein) (Biotin)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-124-3p Vector
mm30066 500 ng

LentimiRa-Off-mmu-miR-124-3p Vector

Sign In for Pricing
View Details
Adamdec1 Rat Pre-designed siRNA Set A-3 (2-OMe)
HY-170712 1 Each

Adamdec1 Rat Pre-designed siRNA Set A-3 (2-OMe)

Sign In for Pricing
View Details
LCAT Rabbit mAb
MBS9469057-01 0.05 mL

LCAT Rabbit mAb

Sign In for Pricing
View Details
LCAT Rabbit mAb
MBS9469057-02 0.1 mL

LCAT Rabbit mAb

Sign In for Pricing
View Details