Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAXO1 Rabbit Polyclonal Antibody (Biotin)

SAXO1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAM154A, C9orf138

UniProt

Q8IYX7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf138

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_714918

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osgin1 ORF Vector (Rat) (pORF)
ORF072973 1.0 µg DNA

Osgin1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human Cytochrome c oxidase subunit 6A2, mitochondrial (COX6A2) ELISA kit
GTR10414913 96 Well

Human Cytochrome c oxidase subunit 6A2, mitochondrial (COX6A2) ELISA kit

Sign In for Pricing
View Details
IPI-3063 1mg
A16800-1 1 mg

IPI-3063 1mg

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024197-01 0.02 mg

Recombinant Shigella boydii serotype 4 NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024197-02 0.1 mg

Recombinant Shigella boydii serotype 4 NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 NADH-quinone oxidoreductase subunit K (nuoK)
MBS7024197-03 5x 0.1 mg

Recombinant Shigella boydii serotype 4 NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details