Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIX1L Rabbit Polyclonal Antibody (Biotin)

LIX1L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZp762F237, MGC46719

UniProt

Q8IVB5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LIX1L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_714924

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphA1, NT (EPHA1, EPH, EPHT, EPHT1, Ephrin type-A receptor 1, EPH tyrosine kinase, EPH tyrosine kinase 1, Erythropoietin-producing hepatoma receptor, Tyrosine-protein kinase receptor EPH) (APC)
MBS6295964-01 0.2 mL

EphA1, NT (EPHA1, EPH, EPHT, EPHT1, Ephrin type-A receptor 1, EPH tyrosine kinase, EPH tyrosine kinase 1, Erythropoietin-producing hepatoma receptor, Tyrosine-protein kinase receptor EPH) (APC)

Sign In for Pricing
View Details
EphA1, NT (EPHA1, EPH, EPHT, EPHT1, Ephrin type-A receptor 1, EPH tyrosine kinase, EPH tyrosine kinase 1, Erythropoietin-producing hepatoma receptor, Tyrosine-protein kinase receptor EPH) (APC)
MBS6295964-02 5x 0.2 mL

EphA1, NT (EPHA1, EPH, EPHT, EPHT1, Ephrin type-A receptor 1, EPH tyrosine kinase, EPH tyrosine kinase 1, Erythropoietin-producing hepatoma receptor, Tyrosine-protein kinase receptor EPH) (APC)

Sign In for Pricing
View Details
SGK196 Antibody
orb1317257 100 µL

SGK196 Antibody

Sign In for Pricing
View Details
Human nGamma-aminobutyric Acid B Receptor 2,GABARB2 ELISA KIT
JOT-EK7423Hu-01 48 Well

Human nGamma-aminobutyric Acid B Receptor 2,GABARB2 ELISA KIT

Sign In for Pricing
View Details
Human nGamma-aminobutyric Acid B Receptor 2,GABARB2 ELISA KIT
JOT-EK7423Hu-02 96 Well

Human nGamma-aminobutyric Acid B Receptor 2,GABARB2 ELISA KIT

Sign In for Pricing
View Details
hsa-miR-4746-5p miRNA Antagomir
MNH02640 2x 5.0 nmol

hsa-miR-4746-5p miRNA Antagomir

Sign In for Pricing
View Details