Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHDC1 Rabbit Polyclonal Antibody (HRP)

KLHDC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MST025

UniProt

Q8N7A1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHDC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_751943

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G4B Antibody
MBS9609746-01 0.1 mL

PLA2G4B Antibody

Sign In for Pricing
View Details
PLA2G4B Antibody
MBS9609746-02 0.2 mL

PLA2G4B Antibody

Sign In for Pricing
View Details
PLA2G4B Antibody
MBS9609746-03 5x 0.2 mL

PLA2G4B Antibody

Sign In for Pricing
View Details
SLCO1B1, ID (SLCO1B1, LST1, OATP1B1, OATP2, OATPC, SLC21A6, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1, OATP-C, Sodium-independent organic anion-transporting polypeptide 2, Solute carrier family 21 member 6) (Azide free) (HRP) discontinued
042000-HRP 200 µL

SLCO1B1, ID (SLCO1B1, LST1, OATP1B1, OATP2, OATPC, SLC21A6, Solute carrier organic anion transporter family member 1B1, Liver-specific organic anion transporter 1, OATP-C, Sodium-independent organic anion-transporting polypeptide 2, Solute carrier family 21 member 6) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Lentiviral human FER1L5 sgRNA gene knockout kit - Lentiviral human FER1L5 sgRNA gene knockout kit (plasmid)
GTR15391550 1 Vial

Lentiviral human FER1L5 sgRNA gene knockout kit - Lentiviral human FER1L5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
MAD1 Antibody
MBS9503970-01 0.05 mL

MAD1 Antibody

Sign In for Pricing
View Details