Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D3 Rabbit Polyclonal Antibody (HRP)

DCUN1D3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DCNL3, 44M2.4, SCCRO3

UniProt

Q8IWE4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DCUN1D3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1D antibody
MBS9402911-01 0.05 mL

C1D antibody

Sign In for Pricing
View Details
C1D antibody
MBS9402911-02 0.1 mL

C1D antibody

Sign In for Pricing
View Details
C1D antibody
MBS9402911-03 5x 0.1 mL

C1D antibody

Sign In for Pricing
View Details
DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (MaxLight 490)
MBS6472940-01 0.1 mL

DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (MaxLight 490)

Sign In for Pricing
View Details
DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (MaxLight 490)
MBS6472940-02 5x 0.1 mL

DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (MaxLight 490)

Sign In for Pricing
View Details
Anti-POLA2 Antibody Picoband® Fluoro594 Conjugated
A08427-2-Fluoro594 100 µg/Vial

Anti-POLA2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details