Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D3 Rabbit Polyclonal Antibody (HRP)

DCUN1D3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DCNL3, 44M2.4, SCCRO3

UniProt

Q8IWE4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DCUN1D3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFE2L3 antibody - middle region (ARP33727_P050)
ARP33727_P050 100 µL

NFE2L3 antibody - middle region (ARP33727_P050)

Sign In for Pricing
View Details
Rabbit anti-human Amine oxidase [flavin-containing] B
OACA00617-100UG 100 µg

Rabbit anti-human Amine oxidase [flavin-containing] B

Sign In for Pricing
View Details
MAP2K1 ELISA Kit (Human) (OKCD08502)
OKCD08502 96 Well

MAP2K1 ELISA Kit (Human) (OKCD08502)

Sign In for Pricing
View Details
CD314 (NKG2D) Antibody (FITC)
abx201091 100 Tests

CD314 (NKG2D) Antibody (FITC)

Sign In for Pricing
View Details
Mrps31 3'UTR GFP Stable Cell Line
TU263451 1.0 mL

Mrps31 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PLGF (Placenta Growth Factor, Placental Growth Factor, PGF, PGFL, D12S1900, PlGF-2, SHGC-10760) (Biotin)
131473-Biotin 100 µL

PLGF (Placenta Growth Factor, Placental Growth Factor, PGF, PGFL, D12S1900, PlGF-2, SHGC-10760) (Biotin)

Sign In for Pricing
View Details