Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cntd1 Rabbit Polyclonal Antibody (HRP)

Cntd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1564542

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQLHATCLTLLDLVYLLHEPIYESLLRASIENSPPSQLQGEKFISVKEDF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001184146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Actin cytoskeleton-regulatory complex protein SLA1 (SLA1), partial
MBS1057900 Inquire

Recombinant Saccharomyces cerevisiae Actin cytoskeleton-regulatory complex protein SLA1 (SLA1), partial

Sign In for Pricing
View Details
STAC3 (E-2) P
sc-514742 P 100 µg - 0.5 mL

STAC3 (E-2) P

Sign In for Pricing
View Details
Phospho-FSCN1 (Ser39) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-0772R-PerCP-Cy5.5 100 µL

Phospho-FSCN1 (Ser39) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human Anti-liver cytosol Anti-body type 1 (LC1) ELISA Kit
NSL1107Hu 96 Tests

Human Anti-liver cytosol Anti-body type 1 (LC1) ELISA Kit

Sign In for Pricing
View Details
POLD2 Antibody
OAAN03606-200UL 200 µL

POLD2 Antibody

Sign In for Pricing
View Details
ZNF740 Protein Vector (Human) (pPB-C-His)
PV145586 500 ng

ZNF740 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details