Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIP5KL1 Rabbit Polyclonal Antibody (HRP)

PIP5KL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIPKH

UniProt

Q5T9C9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHEDERGPGSSLIFR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001128691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal to Human TM4SF6 / TSPAN6
MBS243462-01 0.05 mg

Rabbit Polyclonal to Human TM4SF6 / TSPAN6

Sign In for Pricing
View Details
Rabbit Polyclonal to Human TM4SF6 / TSPAN6
MBS243462-02 5x 0.05 mg

Rabbit Polyclonal to Human TM4SF6 / TSPAN6

Sign In for Pricing
View Details
RET (NM_020975) Human Mutant ORF Clone
RC403332 10 µg

RET (NM_020975) Human Mutant ORF Clone

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Inhibin Beta C (INHbC)
MBS2106936-01 0.1 mL

HRP-Linked Monoclonal Antibody to Inhibin Beta C (INHbC)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Inhibin Beta C (INHbC)
MBS2106936-02 0.2 mL

HRP-Linked Monoclonal Antibody to Inhibin Beta C (INHbC)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Inhibin Beta C (INHbC)
MBS2106936-03 0.5 mL

HRP-Linked Monoclonal Antibody to Inhibin Beta C (INHbC)

Sign In for Pricing
View Details