Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8orf45 Rabbit Polyclonal Antibody (FITC)

C8orf45 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C8orf45

UniProt

Q4G0Z9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C8orf45

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSITVYIPGKKFGEDIDQQMTFPVQCSFWSFVDVDSSSRRNAQKINTLIG

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCL1 (Achaete-scute Complex Homolog 1 (Drosophila), ASH1, HASH1, MASH1, bHLHa46) (MaxLight 550)
MBS6215908-01 0.1 mL

ASCL1 (Achaete-scute Complex Homolog 1 (Drosophila), ASH1, HASH1, MASH1, bHLHa46) (MaxLight 550)

Sign In for Pricing
View Details
ASCL1 (Achaete-scute Complex Homolog 1 (Drosophila), ASH1, HASH1, MASH1, bHLHa46) (MaxLight 550)
MBS6215908-02 5x 0.1 mL

ASCL1 (Achaete-scute Complex Homolog 1 (Drosophila), ASH1, HASH1, MASH1, bHLHa46) (MaxLight 550)

Sign In for Pricing
View Details
ATP-binding cassette sub-family G member 8 (ABCG8) Guinea Pig ELISA Kit
B7354 96 Tests

ATP-binding cassette sub-family G member 8 (ABCG8) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
AdmiRa-hsa-miR-17-3p Virus
mh1629 250 µL

AdmiRa-hsa-miR-17-3p Virus

Sign In for Pricing
View Details
TGFBI (Transforming Growth Factor-beta-induced Protein ig-h3, BIGH3, Beta ig-h3, Kerato-epithelin, RGD-containing Collagen-associated Protein, RGD-CAP) (MaxLight 650)
MBS6396420-01 0.1 mL

TGFBI (Transforming Growth Factor-beta-induced Protein ig-h3, BIGH3, Beta ig-h3, Kerato-epithelin, RGD-containing Collagen-associated Protein, RGD-CAP) (MaxLight 650)

Sign In for Pricing
View Details
TGFBI (Transforming Growth Factor-beta-induced Protein ig-h3, BIGH3, Beta ig-h3, Kerato-epithelin, RGD-containing Collagen-associated Protein, RGD-CAP) (MaxLight 650)
MBS6396420-02 5x 0.1 mL

TGFBI (Transforming Growth Factor-beta-induced Protein ig-h3, BIGH3, Beta ig-h3, Kerato-epithelin, RGD-containing Collagen-associated Protein, RGD-CAP) (MaxLight 650)

Sign In for Pricing
View Details