Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP161 Rabbit Polyclonal Antibody (HRP)

CFAP161 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C15orf26

UniProt

Q6P656

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C15orf26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_775799

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Pepsin B, PGB ELISA KIT
ELI-21572d 96 Tests

Canine Pepsin B, PGB ELISA KIT

Sign In for Pricing
View Details
Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) Antibody
abx172771-01 200 µg

Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) Antibody

Sign In for Pricing
View Details
Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) Antibody
abx172771-02 1 mg

Heparan Sulfate-6-O-Sulfotransferase 1 (HS6ST1) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal PDGF R beta Antibody (18A2) [Alexa Fluor 700]
NBP1-47232AF700 0.1 mL

Mouse Monoclonal PDGF R beta Antibody (18A2) [Alexa Fluor 700]

Sign In for Pricing
View Details
Cthrc1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3703302 1.0 µg DNA

Cthrc1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Lentiviral human LRRC31 sgRNA gene knockout kit - Lentiviral human LRRC31 sgRNA gene knockout kit (plasmid)
GTR15389036 1 Vial

Lentiviral human LRRC31 sgRNA gene knockout kit - Lentiviral human LRRC31 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details