Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCP2 Rabbit Polyclonal Antibody (FITC)

PCP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GPSM4

UniProt

Q8IVA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_777555

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ERP27 Protein
NBP1-50913-0.05mg 0.05 mg

Recombinant Human ERP27 Protein

Sign In for Pricing
View Details
Human C-telopeptide of type I collagen (CTX-I) ELISA Kit
KTE62193-01 48 Tests

Human C-telopeptide of type I collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Human C-telopeptide of type I collagen (CTX-I) ELISA Kit
KTE62193-02 96 Tests

Human C-telopeptide of type I collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Human C-telopeptide of type I collagen (CTX-I) ELISA Kit
KTE62193-03 5x 96 Tests

Human C-telopeptide of type I collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Human C-telopeptide of type I collagen (CTX-I) ELISA Kit
KTE62193-04 50x 96 Tests

Human C-telopeptide of type I collagen (CTX-I) ELISA Kit

Sign In for Pricing
View Details
Rab GTPase-Activating Protein 1-Like, Isoform 10 (RABGAP1L) Antibody (HRP)
abx313437-01 20 µg

Rab GTPase-Activating Protein 1-Like, Isoform 10 (RABGAP1L) Antibody (HRP)

Sign In for Pricing
View Details