Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSF3 Rabbit Polyclonal Antibody (HRP)

ACSF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

F5H5A1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ACSF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTGGYKVS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001271245.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPG Overexpression Lysate (Native) - (Dry Ice)
NBL1-10323 0.1 mg

XPG Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
RNF138 Recombinant Protein (Mouse)
RP168479 100 µg

RNF138 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
TMEM86B AAV Vector (Human) (CMV)
47100101 1 µg

TMEM86B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mouse mmu-miR-6956-5p miRNA Antagomir
abx889213-01 10 nmol

Mouse mmu-miR-6956-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-6956-5p miRNA Antagomir
abx889213-02 20 nmol

Mouse mmu-miR-6956-5p miRNA Antagomir

Sign In for Pricing
View Details
CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (MaxLight 405) discontinued
143659-ML405 100 µL

CCL15 (C-C Motif Chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage Inflammatory Protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible Cytokine A15, MIP5, NCC3, SCYA15) (MaxLight 405) discontinued

Sign In for Pricing
View Details