Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSF3 Rabbit Polyclonal Antibody (HRP)

ACSF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

F5H5A1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ACSF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTGGYKVS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001271245.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA 15-3 (Breast Tumor, 15-3, MUC1, MUC-1) (MaxLight 650) discontinued
226859-ML650 100 µL

CA 15-3 (Breast Tumor, 15-3, MUC1, MUC-1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Zebrafish Runx3 Protein, N-GST & C-His
orb2961705-01 50 µg

Recombinant Zebrafish Runx3 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Zebrafish Runx3 Protein, N-GST & C-His
orb2961705-02 100 µg

Recombinant Zebrafish Runx3 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Zebrafish Runx3 Protein, N-GST & C-His
orb2961705-03 1 mg

Recombinant Zebrafish Runx3 Protein, N-GST & C-His

Sign In for Pricing
View Details
N-Propyl Alcohol 99% For Synthesis
02204 00500 500 mL

N-Propyl Alcohol 99% For Synthesis

Sign In for Pricing
View Details
Progesterone Receptor
CR323-0.1ml 0.1 mL

Progesterone Receptor

Sign In for Pricing
View Details