Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SVOPL Rabbit Polyclonal Antibody (FITC)

SVOPL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SVOPL

UniProt

Q8N434

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SVOPL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLRALVAANFNTVYIYTAEVYPTTMRALGMGTSGSLCRIGAMVAPFISQV

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Bspry  ELISA Kit
EF018364 96 Tests

Rat Bspry ELISA Kit

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL
BNC472883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LC3C, Phosphorylated (S12) (MAP1LC3A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-assoc
MBS6315411-01 0.1 mL

LC3C, Phosphorylated (S12) (MAP1LC3A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-assoc

Sign In for Pricing
View Details
LC3C, Phosphorylated (S12) (MAP1LC3A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-assoc
MBS6315411-02 5x 0.1 mL

LC3C, Phosphorylated (S12) (MAP1LC3A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-assoc

Sign In for Pricing
View Details
ELISA Kit For Galanin receptor type 2
E10506m 96 Tests

ELISA Kit For Galanin receptor type 2

Sign In for Pricing
View Details
A2M Antibody
orb2312294-01 20 µg

A2M Antibody

Sign In for Pricing
View Details