Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC8 Rabbit Polyclonal Antibody (FITC)

EXOC8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EXO84, SEC84, Exo84p, NEDMISB

UniProt

Q8IYI6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_787072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr31 Mouse shRNA Plasmid (Locus ID 18330)
TL514114 1 Kit

Olfr31 Mouse shRNA Plasmid (Locus ID 18330)

Sign In for Pricing
View Details
Esophagus cancer with matched lymph node metastatic carcinoa tissue array, including pathology grade, TNM and clinical stage, 40 cases/80 cores, replacing ES810
ES810a 40 Cases / 80 Cores

Esophagus cancer with matched lymph node metastatic carcinoa tissue array, including pathology grade, TNM and clinical stage, 40 cases/80 cores, replacing ES810

Sign In for Pricing
View Details
4- (4-Cyclopropylpiperazin-1-yl) aniline
OR13813 1 Each

4- (4-Cyclopropylpiperazin-1-yl) aniline

Sign In for Pricing
View Details
FUBP1 Antibody
MBS7136493-01 0.05 mL

FUBP1 Antibody

Sign In for Pricing
View Details
FUBP1 Antibody
MBS7136493-02 0.1 mL

FUBP1 Antibody

Sign In for Pricing
View Details
FUBP1 Antibody
MBS7136493-03 5x 0.1 mL

FUBP1 Antibody

Sign In for Pricing
View Details