Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC8 Rabbit Polyclonal Antibody (FITC)

EXOC8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EXO84, SEC84, Exo84p, NEDMISB

UniProt

Q8IYI6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_787072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CASS4 shRNA (UAS) - Lentiviral human CASS4 shRNA (UAS, GFP) (25)
GTR15313199 1 Vial

Lentiviral human CASS4 shRNA (UAS) - Lentiviral human CASS4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit anti-Drosophila virilis (Fruit fly) Pcd Polyclonal Antibody
MBS7140967 Inquire

Rabbit anti-Drosophila virilis (Fruit fly) Pcd Polyclonal Antibody

Sign In for Pricing
View Details
Human Retinoic Acid Receptor Gamma (RARg) ELISA Kit
EKU07096-01 48 Tests

Human Retinoic Acid Receptor Gamma (RARg) ELISA Kit

Sign In for Pricing
View Details
Human Retinoic Acid Receptor Gamma (RARg) ELISA Kit
EKU07096-02 96 Tests

Human Retinoic Acid Receptor Gamma (RARg) ELISA Kit

Sign In for Pricing
View Details
Human Retinoic Acid Receptor Gamma (RARg) ELISA Kit
EKU07096-03 5x 96 Tests

Human Retinoic Acid Receptor Gamma (RARg) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse ST6GALNAC2 CF
6468-GT-020 20 µg

Recombinant Mouse ST6GALNAC2 CF

Sign In for Pricing
View Details