Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ODF3L1 Rabbit Polyclonal Antibody (HRP)

ODF3L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC48986

UniProt

Q8IXM7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ODF3L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_787077

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Schistocerca Gregaria Whole Exon Panel
PH2010030-01 4 Reactions

Schistocerca Gregaria Whole Exon Panel

Sign In for Pricing
View Details
Schistocerca Gregaria Whole Exon Panel
PH2010030-02 4 Reactions

Schistocerca Gregaria Whole Exon Panel

Sign In for Pricing
View Details
Sheep Troponin C Type 2, Fast ELISA Kit
MBS005669-01 48 Well

Sheep Troponin C Type 2, Fast ELISA Kit

Sign In for Pricing
View Details
Sheep Troponin C Type 2, Fast ELISA Kit
MBS005669-02 96 Well

Sheep Troponin C Type 2, Fast ELISA Kit

Sign In for Pricing
View Details
Sheep Troponin C Type 2, Fast ELISA Kit
MBS005669-03 5x 96 Well

Sheep Troponin C Type 2, Fast ELISA Kit

Sign In for Pricing
View Details
Sheep Troponin C Type 2, Fast ELISA Kit
MBS005669-04 10x 96 Well

Sheep Troponin C Type 2, Fast ELISA Kit

Sign In for Pricing
View Details