Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP4B Rabbit Polyclonal Antibody (HRP)

CHMP4B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SNF7, CTPP3, Shax1, CHMP4A, SNF7-2, VPS32B, CTRCT31, Vps32-2, C20orf178, dJ553F4.4

UniProt

Q9H444

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_789782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Carassius Auratus Leptin (N-8His)
CM20-1mg 1 mg

Recombinant Carassius Auratus Leptin (N-8His)

Sign In for Pricing
View Details
EYA3 Knockout Raji Polyclonal Cells
ARG1260 1 Million

EYA3 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, AITRL, GITRL, TL6, hGITRL)
368467 100 µg

TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, AITRL, GITRL, TL6, hGITRL)

Sign In for Pricing
View Details
Insulin-Like Growth Factor I Receptor, alpha (IGF1Ra) (BSA & Azide Free) (MaxLight 490) discontinued
I7661-21FX-ML490 100 µL

Insulin-Like Growth Factor I Receptor, alpha (IGF1Ra) (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details
RPL7P43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV775819 1.0 µg DNA

RPL7P43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
PLCZ1 Protein Vector (Rat) (pPB-C-His)
PV294494 500 ng

PLCZ1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details