Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB6 Rabbit Polyclonal Antibody (Biotin)

ASB6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ20548, MGC1024

UniProt

Q9NWX5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ASB6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human APOA1 shRNA (UAS) - Lentiviral human APOA1 shRNA (UAS) (25)
GTR15084857 1 Vial

Lentiviral human APOA1 shRNA (UAS) - Lentiviral human APOA1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human Atrial natriuretic peptide receptor 2 ELISA Kit
MBS9426648-01 96 Tests

Human Atrial natriuretic peptide receptor 2 ELISA Kit

Sign In for Pricing
View Details
Human Atrial natriuretic peptide receptor 2 ELISA Kit
MBS9426648-02 5x 96 Tests

Human Atrial natriuretic peptide receptor 2 ELISA Kit

Sign In for Pricing
View Details
RPS27A Human Gene Knockout Kit (CRISPR)
KN409696 1 Kit

RPS27A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Foxg1 Rat siRNA Oligo Duplex (Locus ID 24370)
SR512961 1 Kit

Foxg1 Rat siRNA Oligo Duplex (Locus ID 24370)

Sign In for Pricing
View Details
KIF2A Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2493815 100 µL

KIF2A Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details