Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RETREG3 Rabbit Polyclonal Antibody (Biotin)

RETREG3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAM134C

UniProt

Q86VR2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM134C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA) (19-131) mouse monoclonal antibody, clone 3A5, Purified
AM31705PU-N 50 µg

Chromogranin A (CHGA) (19-131) mouse monoclonal antibody, clone 3A5, Purified

Sign In for Pricing
View Details
(R) -4-Methyl-3,4-dihydro-2H-benzo[b][1,4,5]oxathiazepine 1,1-dioxide
OR1056770 250 mg

(R) -4-Methyl-3,4-dihydro-2H-benzo[b][1,4,5]oxathiazepine 1,1-dioxide

Sign In for Pricing
View Details
RNF32 Rabbit Polyclonal Antibody
orb578793 100 µL

RNF32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R3B (Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B'' Subunit beta, PP2A Subunit B Isoform PR48, Protein Phosphatase 2A 48kD Regulatory Subunit, PPP2R3L, FLJ60425, NYREN8, PPP2R3LY) (MaxLight 405) discontinued
131718-ML405 100 µL

PPP2R3B (Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B'' Subunit beta, PP2A Subunit B Isoform PR48, Protein Phosphatase 2A 48kD Regulatory Subunit, PPP2R3L, FLJ60425, NYREN8, PPP2R3LY) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-Neuron Derived Neurotrophic Factor (NDNF)
FY-AB50867-01 1 mL

Anti-Neuron Derived Neurotrophic Factor (NDNF)

Sign In for Pricing
View Details
Anti-Neuron Derived Neurotrophic Factor (NDNF)
FY-AB50867-02 100 µL

Anti-Neuron Derived Neurotrophic Factor (NDNF)

Sign In for Pricing
View Details