Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC50 Rabbit Polyclonal Antibody (FITC)

CCDC50 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

YMER, C3orf6, DFNA44

UniProt

Q8IVM0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CCDC50

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848018

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST2H4A Protein Vector (Human) (pPM-C-His)
PV083128 500 ng

HIST2H4A Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)
TRV-0001103-01 24 Tests

ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)

Sign In for Pricing
View Details
ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)
TRV-0001103-02 48 Tests

ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)

Sign In for Pricing
View Details
ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)
TRV-0001103-03 96 Tests

ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)

Sign In for Pricing
View Details
ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)
TRV-0001103-04 5x 96 Tests

ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)

Sign In for Pricing
View Details
ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)
TRV-0001103-05 10x 96 Tests

ELISA Kit for Anti-Proprotein Convertase Subtilisin/Kexin Type 9 Antibody (Anti-PCSK9)

Sign In for Pricing
View Details