Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH2 Rabbit Polyclonal Antibody (FITC)

PTH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIP39

UniProt

Q96A98

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PTH2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848544

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphB3, Human (HEK293, His)
HY-P77931-01 20 µg

EphB3, Human (HEK293, His)

Sign In for Pricing
View Details
EphB3, Human (HEK293, His)
HY-P77931-02 50 µg

EphB3, Human (HEK293, His)

Sign In for Pricing
View Details
EphB3, Human (HEK293, His)
HY-P77931-03 100 µg

EphB3, Human (HEK293, His)

Sign In for Pricing
View Details
Elongin A, NT (TCEB3, Transcription elongation factor B polypeptide 3, Elongin 110kD subunit, Elongin-A, RNA polymerase II transcription factor SIII subunit A1, SIII p110) (MaxLight 550)
MBS6295343-01 0.1 mL

Elongin A, NT (TCEB3, Transcription elongation factor B polypeptide 3, Elongin 110kD subunit, Elongin-A, RNA polymerase II transcription factor SIII subunit A1, SIII p110) (MaxLight 550)

Sign In for Pricing
View Details
Elongin A, NT (TCEB3, Transcription elongation factor B polypeptide 3, Elongin 110kD subunit, Elongin-A, RNA polymerase II transcription factor SIII subunit A1, SIII p110) (MaxLight 550)
MBS6295343-02 5x 0.1 mL

Elongin A, NT (TCEB3, Transcription elongation factor B polypeptide 3, Elongin 110kD subunit, Elongin-A, RNA polymerase II transcription factor SIII subunit A1, SIII p110) (MaxLight 550)

Sign In for Pricing
View Details
Canine Doublecortin ELISA Kit
MBS737572-01 48 Well

Canine Doublecortin ELISA Kit

Sign In for Pricing
View Details