Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC50 Rabbit Polyclonal Antibody (Biotin)

LRRC50 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Swt, DAU1, ODA7, CILD13, LRRC50

UniProt

Q8NEP3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTF1A Mouse Monoclonal Antibody [Clone ID: LBI1H6]
AMM19952VCF 100 µg

PTF1A Mouse Monoclonal Antibody [Clone ID: LBI1H6]

Sign In for Pricing
View Details
Mouse Rtn1 activation kit by CRISPRa
GA211776 1 Kit

Mouse Rtn1 activation kit by CRISPRa

Sign In for Pricing
View Details
SULT2B1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2313303 1.0 µg DNA

SULT2B1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1) (MaxLight 550)
127674-ML550 100 µL

GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1) (MaxLight 550)

Sign In for Pricing
View Details
BeyoZonaseTM Super Nuclease, ≥99%, with His-tag
D7126-100KU 100 KU

BeyoZonaseTM Super Nuclease, ≥99%, with His-tag

Sign In for Pricing
View Details
Mouse Monoclonal EMMPRIN/CD147 Antibody (OTI9H5) [Alexa Fluor 488]
NBP2-70278AF488 0.1 mL

Mouse Monoclonal EMMPRIN/CD147 Antibody (OTI9H5) [Alexa Fluor 488]

Sign In for Pricing
View Details