Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC50 Rabbit Polyclonal Antibody (Biotin)

LRRC50 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Swt, DAU1, ODA7, CILD13, LRRC50

UniProt

Q8NEP3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_848547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem72-set siRNA/shRNA/RNAi Lentivector (Rat)
47086096 4x 500 ng

Tmem72-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Pum2 (Pumilio 2, Pumilio-2, PUM-2, FLJ36528, KIAA0235, MGC138251, MGC138253, Pumilio (Drosphila) Homolog 2, Pumilio Homolog 2 (Drosophila), PUMH2, Pumilio-like 2, Pumilio-like Protein 2, PUML2) (HRP) discontinued
P9196-80D-HRP 100 µL

Pum2 (Pumilio 2, Pumilio-2, PUM-2, FLJ36528, KIAA0235, MGC138251, MGC138253, Pumilio (Drosphila) Homolog 2, Pumilio Homolog 2 (Drosophila), PUMH2, Pumilio-like 2, Pumilio-like Protein 2, PUML2) (HRP) discontinued

Sign In for Pricing
View Details
Tsc1 (BC052399) Mouse Tagged ORF Clone Lentiviral Particle
MR211709L4V 200 µL

Tsc1 (BC052399) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCL1, Recombinant, Human, aa24-96, His-Tag (Chemokine C-C motif ligand 1, I-309, P500, SCYA1, SISe, TCA3)
351129-01 50 µg

CCL1, Recombinant, Human, aa24-96, His-Tag (Chemokine C-C motif ligand 1, I-309, P500, SCYA1, SISe, TCA3)

Sign In for Pricing
View Details
CCL1, Recombinant, Human, aa24-96, His-Tag (Chemokine C-C motif ligand 1, I-309, P500, SCYA1, SISe, TCA3)
351129-02 250 µg

CCL1, Recombinant, Human, aa24-96, His-Tag (Chemokine C-C motif ligand 1, I-309, P500, SCYA1, SISe, TCA3)

Sign In for Pricing
View Details
NativeExtract™ Human GPR78 Membrane Protein (Full length, Super Nanodisc)
S01YF-1023-KX196 10 μg

NativeExtract™ Human GPR78 Membrane Protein (Full length, Super Nanodisc)

Sign In for Pricing
View Details