Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morn4 Rabbit Polyclonal Antibody (HRP)

Morn4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

2810038N09Rik

UniProt

Q9CZ83

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAVVQRAQSASKSARNLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080311

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF640R conjugate, 0.1mg/mL
BNC401386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS700522 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
TRITC Conjugated Amaranthus caudatus Lectin (Tassel flowerInca wheat) -ACA-
R-8201-2 2 mg

TRITC Conjugated Amaranthus caudatus Lectin (Tassel flowerInca wheat) -ACA-

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF568 conjugate, 0.1mg/mL
BNC682266-100 1x 100 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HEPN1 Human Gene Knockout Kit (CRISPR)
KN417514 1 Kit

HEPN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), Biotin conjugate, 0.1mg/mL
BNCB2290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details