Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAYN Rabbit Polyclonal Antibody (FITC)

LAYN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ30977, FLJ31092

UniProt

Q6UX15

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LAYN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_849156

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse glutamic acid decarboxylase AutoAntibody IgG, GAD autoAb IgG ELISA KIT
ED0051Mo-01 96 Well

Mouse glutamic acid decarboxylase AutoAntibody IgG, GAD autoAb IgG ELISA KIT

Sign In for Pricing
View Details
Mouse glutamic acid decarboxylase AutoAntibody IgG, GAD autoAb IgG ELISA KIT
ED0051Mo-02 5x 96 Tests

Mouse glutamic acid decarboxylase AutoAntibody IgG, GAD autoAb IgG ELISA KIT

Sign In for Pricing
View Details
Mouse glutamic acid decarboxylase AutoAntibody IgG, GAD autoAb IgG ELISA KIT
ED0051Mo-03 10x 96 Tests

Mouse glutamic acid decarboxylase AutoAntibody IgG, GAD autoAb IgG ELISA KIT

Sign In for Pricing
View Details
PKC Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62958R-BF594-TR 20 µL

PKC Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rhodopsin (MGC138309, MGC138311, OPSD, Opsin 2, Opsin 2 Rod Pigment, Opsin-2, OPN2, Retinitis Pigmentosa 4, Retinitis Pigmentosa 4 Autosomal Dominant, RP4) (HRP) discontinued
R1998-15-HRP 100 µL

Rhodopsin (MGC138309, MGC138311, OPSD, Opsin 2, Opsin 2 Rod Pigment, Opsin-2, OPN2, Retinitis Pigmentosa 4, Retinitis Pigmentosa 4 Autosomal Dominant, RP4) (HRP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal GTP binding protein era homolog Antibody
NBP1-57493 100 µL

Rabbit Polyclonal GTP binding protein era homolog Antibody

Sign In for Pricing
View Details