Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl55 Rabbit Polyclonal Antibody (HRP)

Mrpl55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L55mt, MRP-L55, 2810038N09Rik

UniProt

Q7Z7F7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_852106

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD123 polyclonal antibody
orb2298444-01 50 µL

CD123 polyclonal antibody

Sign In for Pricing
View Details
CD123 polyclonal antibody
orb2298444-02 100 µL

CD123 polyclonal antibody

Sign In for Pricing
View Details
CD123 polyclonal antibody
orb2298444-03 200 µL

CD123 polyclonal antibody

Sign In for Pricing
View Details
Rabbit Anti-Human FUT6 pAb
PA13554-01 50 μL

Rabbit Anti-Human FUT6 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human FUT6 pAb
PA13554-02 100 μL

Rabbit Anti-Human FUT6 pAb

Sign In for Pricing
View Details
Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF647 conjugate, 0.1mg/mL
BNC471317-100 1x 100 µL

Thyroid Stimulating Hormone, beta (TSH beta) (Pituitary Marker) (TSHb/1317), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details