Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL55 Rabbit Polyclonal Antibody (FITC)

MRPL55 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L55nt, MRP-L55, AAVG5835, PRO19675

UniProt

D4ACI9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001100736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAFF Receptor (BAFFR, BAFF-R, B Cell-Activating Factor Receptor, BLyS Receptor 3, BR3, CD268, CD268 Antigen, MGC138235, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C)
MBS621537-01 0.1 mg

BAFF Receptor (BAFFR, BAFF-R, B Cell-Activating Factor Receptor, BLyS Receptor 3, BR3, CD268, CD268 Antigen, MGC138235, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C)

Sign In for Pricing
View Details
BAFF Receptor (BAFFR, BAFF-R, B Cell-Activating Factor Receptor, BLyS Receptor 3, BR3, CD268, CD268 Antigen, MGC138235, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C)
MBS621537-02 5x 0.1 mg

BAFF Receptor (BAFFR, BAFF-R, B Cell-Activating Factor Receptor, BLyS Receptor 3, BR3, CD268, CD268 Antigen, MGC138235, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C)

Sign In for Pricing
View Details
PTPRB 3'UTR Luciferase Stable Cell Line
TU019219 1.0 mL

PTPRB 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
S-Tag Antibody [SBSTAGa] (FITC)
orb1251045 0.5 mg

S-Tag Antibody [SBSTAGa] (FITC)

Sign In for Pricing
View Details
Aurin (P-Rosolic Acid) For Microscopy
00317 00025 25 g

Aurin (P-Rosolic Acid) For Microscopy

Sign In for Pricing
View Details
Human ChAT ELISA Kit
E007933 1 Each

Human ChAT ELISA Kit

Sign In for Pricing
View Details