Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD12B Rabbit Polyclonal Antibody (Biotin)

ABHD12B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BEM46L3, C14orf29, c14_5314

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVAS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_853511

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10H4 Recombinant Protein (Human)
RP079410 100 µg

OR10H4 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rotavirus Antibody (FITC)
orb1273274 1 mL

Rotavirus Antibody (FITC)

Sign In for Pricing
View Details
RPI3 Antibody
orb795707 2 mg

RPI3 Antibody

Sign In for Pricing
View Details
Mouse Thioredoxin (TRX) ELISA Kit
AE12703MO-01 48 Tests

Mouse Thioredoxin (TRX) ELISA Kit

Sign In for Pricing
View Details
Mouse Thioredoxin (TRX) ELISA Kit
AE12703MO-02 96 Tests

Mouse Thioredoxin (TRX) ELISA Kit

Sign In for Pricing
View Details
NFAT2 Rabbit Polyclonal Antibody
orb381911-01 30 µL

NFAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details