Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD12B Rabbit Polyclonal Antibody (HRP)

ABHD12B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BEM46L3, C14orf29, c14_5314

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_853511

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL
BNC040183-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Nitro-3-pyridinol
TRC-N519930-100G 100 g

2-Nitro-3-pyridinol

Sign In for Pricing
View Details
FLT3 Rabbit Polyclonal Antibody
TA392483 100 µL

FLT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Scrn1 Mouse Gene Knockout Kit (CRISPR)
KN515403 1 Kit

Scrn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CTPS2 (NM_001144002) Human Over-expression Lysate
LY428462 100 µg

CTPS2 (NM_001144002) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin Recombinant Monoclonal Mouse Antibody (rBN-34), CF®647 Conjugate - Biotium Choice
P033-647-1ML 1x 1 mL

Biotin Recombinant Monoclonal Mouse Antibody (rBN-34), CF®647 Conjugate - Biotium Choice

Sign In for Pricing
View Details