Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubxn2a Rabbit Polyclonal Antibody (Biotin)

Ubxn2a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ubxd4

UniProt

D3ZID8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102952

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pesticide Std Demeton O 1000ug/mL in MeCn - 1ML
REPET328 1 mL

Pesticide Std Demeton O 1000ug/mL in MeCn - 1ML

Sign In for Pricing
View Details
Mouse FOLH1 Protein
orb425571-01 2 µg

Mouse FOLH1 Protein

Sign In for Pricing
View Details
Mouse FOLH1 Protein
orb425571-02 10 µg

Mouse FOLH1 Protein

Sign In for Pricing
View Details
Mouse FOLH1 Protein
orb425571-03 1 mg

Mouse FOLH1 Protein

Sign In for Pricing
View Details
NR4A1, ID (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1)
MBS6003217-01 0.1 mg

NR4A1, ID (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1)

Sign In for Pricing
View Details
NR4A1, ID (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1)
MBS6003217-02 5x 0.1 mg

NR4A1, ID (Nuclear Receptor Subfamily 4 Group A Member 1, Orphan Nuclear Receptor TR3, Orphan Nuclear Receptor HMR, Early Response Protein NAK1, Testicular Receptor 3, ST-59, Nur77, GFRP1, HMR, NAK1)

Sign In for Pricing
View Details