Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AASDH Rabbit Polyclonal Antibody (FITC)

AASDH Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LYS2, ACSF4, NRPS998, NRPS1098

UniProt

Q4L235

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AASDH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

122kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_861522

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRHR, ID (TRHR, Thyrotropin-releasing hormone receptor, Thyroliberin receptor)
043208 200 µL

TRHR, ID (TRHR, Thyrotropin-releasing hormone receptor, Thyroliberin receptor)

Sign In for Pricing
View Details
Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit
MBS7242958-01 48 Well

Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit

Sign In for Pricing
View Details
Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit
MBS7242958-02 96 Well

Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit

Sign In for Pricing
View Details
Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit
MBS7242958-03 5x 96 Well

Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit

Sign In for Pricing
View Details
Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit
MBS7242958-04 10x 96 Well

Mouse CDGSH iron-sulfur domain-containing protein 1 (CISD1) ELISA Kit

Sign In for Pricing
View Details
Ipo4 siRNA Oligos set (Rat)
25030176 3x 5 nmol

Ipo4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details