Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AASDH Rabbit Polyclonal Antibody (HRP)

AASDH Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LYS2, ACSF4, NRPS998, NRPS1098

UniProt

Q4L235

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AASDH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

122kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_861522

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine
D9811-06A-01 10 L

Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine
D9811-06A-02 25 L

Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine
D9811-06A-03 50 L

Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine
D9811-06A-04 100 L

Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine

Sign In for Pricing
View Details
Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine
D9811-06A-05 250 L

Dulbecco’s MEM (DMEM) F-12 w/ HEPES and Sodium Bicarbonate w/o Tyrosine

Sign In for Pricing
View Details
Anti-Daclizumab Neutralizing Recombinant Antibody (SAA2944)
AF996043-01 50 µg

Anti-Daclizumab Neutralizing Recombinant Antibody (SAA2944)

Sign In for Pricing
View Details