Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTERF4 Rabbit Polyclonal Antibody (HRP)

MTERF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mterfd, Mterfd2, 1810059A23Rik, 4933412H03Rik

UniProt

Q8BVN4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LERLGRYQTPDKKGQTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_835152

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NTRK2 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated
NTRK2-158HAF647 20 μg- 50 μg- 100 μg

Recombinant Human NTRK2 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
HIST1H2AG Polyclonal Antibody, Biotin Conjugated
A50288-100 100 µL

HIST1H2AG Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
BAP1 (Ubiquitin C-terminal Hydrolase BAP1, BRCA1 Associated Protein-1 (Ubiquitin C-terminal Hydrolase)
476093 100 µL

BAP1 (Ubiquitin C-terminal Hydrolase BAP1, BRCA1 Associated Protein-1 (Ubiquitin C-terminal Hydrolase)

Sign In for Pricing
View Details
ZBTB18 Antibody (FITC)
abx306036-01 20 µg

ZBTB18 Antibody (FITC)

Sign In for Pricing
View Details
ZBTB18 Antibody (FITC)
abx306036-02 50 µg

ZBTB18 Antibody (FITC)

Sign In for Pricing
View Details
ZBTB18 Antibody (FITC)
abx306036-03 100 µg

ZBTB18 Antibody (FITC)

Sign In for Pricing
View Details