Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

1110059E24Rik Rabbit Polyclonal Antibody (FITC)

1110059E24Rik Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9CQ90

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079699

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial
MBS1169939-01 1 mg (E-Coli)

Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial

Sign In for Pricing
View Details
Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial
MBS1169939-02 1 mg (Yeast)

Recombinant Hepatitis C virus genotype 1a Genome polyprotein, partial

Sign In for Pricing
View Details
RGD1310324 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6074902 1.0 µg DNA

RGD1310324 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
OR52M1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1569008 1.0 µg DNA

OR52M1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Serglycin (SRGN) ELISA Kit
RK07602 96 Tests

Mouse Serglycin (SRGN) ELISA Kit

Sign In for Pricing
View Details
VHL Double Nickase Plasmid (h2)
sc-400528-NIC-2 20 µg

VHL Double Nickase Plasmid (h2)

Sign In for Pricing
View Details