Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

1110059E24Rik Rabbit Polyclonal Antibody (FITC)

1110059E24Rik Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9CQ90

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079699

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLRC4 Rabbit Polyclonal Antibody (HRP)
orb477340 100 µL

KLRC4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Formic Acid 15%
RRDC15-G 5 L

Formic Acid 15%

Sign In for Pricing
View Details
Armenian Hamster Monoclonal B7-1/CD80 Antibody (16-10A1) [Alexa Fluor 647]
NBP1-43385AF647 0.1 mL

Armenian Hamster Monoclonal B7-1/CD80 Antibody (16-10A1) [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Antibody to Transforming Growth Factor Beta 2 (TGFb2)
TRV-0052256-01 20 µL

Recombinant Antibody to Transforming Growth Factor Beta 2 (TGFb2)

Sign In for Pricing
View Details
Recombinant Antibody to Transforming Growth Factor Beta 2 (TGFb2)
TRV-0052256-02 100 µL

Recombinant Antibody to Transforming Growth Factor Beta 2 (TGFb2)

Sign In for Pricing
View Details
Recombinant Antibody to Transforming Growth Factor Beta 2 (TGFb2)
TRV-0052256-03 200 µL

Recombinant Antibody to Transforming Growth Factor Beta 2 (TGFb2)

Sign In for Pricing
View Details