Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

1110059E24Rik Rabbit Polyclonal Antibody (Biotin)

1110059E24Rik Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9CQ90

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079699

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EPO Receptor/EPOR Antibody Picoband® (Dylight594 Conjugate)
A00427-1-Dylight594 100 µg

Anti-EPO Receptor/EPOR Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Cdk13 Mouse Gene Knockout Kit (CRISPR)
KN503030 1 Kit

Cdk13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AVPR1B (Vasopressin V1b Receptor, V1bR, AVPR V1b, AVPR V3, Antidiuretic Hormone Receptor 1b, Vasopressin V3 Receptor, AVPR3, VPR3)
170186 50 µg

AVPR1B (Vasopressin V1b Receptor, V1bR, AVPR V1b, AVPR V3, Antidiuretic Hormone Receptor 1b, Vasopressin V3 Receptor, AVPR3, VPR3)

Sign In for Pricing
View Details
NG2 Rabbit Polyclonal Antibody (BF405)
orb2408251 100 µL

NG2 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Olr731 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV637696 1.0 µg DNA

Olr731 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Psychrobacter sp. Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1182680-01 0.02 mg (E-Coli)

Recombinant Psychrobacter sp. Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details