Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THAP5 Rabbit Polyclonal Antibody (Biotin)

THAP5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q7Z6K1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human THAP5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001123947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRSP8 (P37 TRAP/SMCC/PC2 Subunit, Transcriptional Coactivator CRSP34, CRSP Complex Subunit 8, Cofactor Required For Sp1 Transcriptional Activation Subunit 8, Mediator Complex Subunit 27, Mediator Of RNA Polymerase II Transcription Subunit 27, MED27, CRSP34) (HRP)
125353-HRP 100 µL

CRSP8 (P37 TRAP/SMCC/PC2 Subunit, Transcriptional Coactivator CRSP34, CRSP Complex Subunit 8, Cofactor Required For Sp1 Transcriptional Activation Subunit 8, Mediator Complex Subunit 27, Mediator Of RNA Polymerase II Transcription Subunit 27, MED27, CRSP34) (HRP)

Sign In for Pricing
View Details
OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) (MaxLight 750)
MBS6387885-01 0.1 mL

OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) (MaxLight 750)

Sign In for Pricing
View Details
OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) (MaxLight 750)
MBS6387885-02 5x 0.1 mL

OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) (MaxLight 750)

Sign In for Pricing
View Details
Human FXR1 Knockout HEK293T cell line
GTR15418939 1 Vial

Human FXR1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Density Balance (BFT-2504)
BFT-2504 1 Unit

Density Balance (BFT-2504)

Sign In for Pricing
View Details
Kinesis 47mm 0.45um Hydrophilic PVDF Membrane Disc
CHR1286 100 / PCK

Kinesis 47mm 0.45um Hydrophilic PVDF Membrane Disc

Sign In for Pricing
View Details