Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCTE1 Rabbit Polyclonal Antibody (HRP)

TCTE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRC5, D6S46, FAP155

UniProt

Q5JU00

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCTE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_872345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR65 siRNA Oligos set (Human)
22580171 3x 5 nmol

GPR65 siRNA Oligos set (Human)

Sign In for Pricing
View Details
KRT86 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV624093 1.0 µg DNA

KRT86 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
NALP4 Rabbit Polyclonal Antibody (AP)
orb885034 100 µL

NALP4 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Mouse Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA kit
GTR10452874 96 Well

Mouse Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA kit

Sign In for Pricing
View Details
HMGA1 Rabbit pAb
MBS8544497-01 0.1 mL

HMGA1 Rabbit pAb

Sign In for Pricing
View Details
HMGA1 Rabbit pAb
MBS8544497-02 0.1 mL (AF405L)

HMGA1 Rabbit pAb

Sign In for Pricing
View Details