Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phactr3 Rabbit Polyclonal Antibody (Biotin)

Phactr3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, H17739, Scapin1, Scapinin, mKIAA4224, 1500003N10Rik, 4930415A02Rik

UniProt

Q6KCA9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VTTVHRPLPPSRVMEELHRALATKHRQDSFQGRECRGSPKKRMDVRLSRT

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001007155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS-14 (G-8) AC
sc-373773 AC 500 µg/mL - 25% ag

ADAMTS-14 (G-8) AC

Sign In for Pricing
View Details
SIRT1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0921R-BF680-01 20 µL

SIRT1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
SIRT1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0921R-BF680-02 100 µL

SIRT1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Human FAM200B Protein
E30P9839 20 µg

Recombinant Human FAM200B Protein

Sign In for Pricing
View Details
Human CDKL1 Pre-designed siRNA Set B
SI002722B 1 Each

Human CDKL1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CNIH3 Lentiviral Activation Particles (m)
sc-428478-LAC 200 µL

CNIH3 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details