Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACTR3 Rabbit Polyclonal Antibody (Biotin)

PHACTR3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H17739, SCAPIN1, PPP1R123, SCAPININ, C20orf101

UniProt

B1AN69

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PHACTR3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_899069

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH22 Rabbit Polyclonal Antibody (FITC)
orb2112843 100 µL

CDH22 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Interleukin-10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF, Il10, Il-10) (MaxLight 750)
MBS6269702-01 0.1 mL

Interleukin-10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF, Il10, Il-10) (MaxLight 750)

Sign In for Pricing
View Details
Interleukin-10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF, Il10, Il-10) (MaxLight 750)
MBS6269702-02 5x 0.1 mL

Interleukin-10 (IL-10, Cytokine Synthesis Inhibitory Factor, CSIF, Il10, Il-10) (MaxLight 750)

Sign In for Pricing
View Details
CD138 Polyclonal Antibody
MBS8521705-01 0.1 mg

CD138 Polyclonal Antibody

Sign In for Pricing
View Details
CD138 Polyclonal Antibody
MBS8521705-02 0.1 mL (AF635)

CD138 Polyclonal Antibody

Sign In for Pricing
View Details
CD138 Polyclonal Antibody
MBS8521705-03 0.1 mL (AF610)

CD138 Polyclonal Antibody

Sign In for Pricing
View Details