Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACTR3 Rabbit Polyclonal Antibody (HRP)

PHACTR3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H17739, SCAPIN1, PPP1R123, SCAPININ, C20orf101

UniProt

B1AN69

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PHACTR3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_899069

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZMAT4 shRNA (UAS) - Lentiviral human ZMAT4 shRNA (UAS, GFP) plasmid
GTR15148678 1 Vial

Lentiviral human ZMAT4 shRNA (UAS) - Lentiviral human ZMAT4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
KIF7 Rabbit Polyclonal Antibody (Biotin)
orb457065 100 µL

KIF7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ITGAL, ID (ITGAL, CD11A, Integrin alpha-L, CD11 antigen-like family member A, Leukocyte adhesion glycoprotein LFA-1 alpha chain, Leukocyte function-associated molecule 1 alpha chain, CD11a) (MaxLight 650)
MBS6311232-01 0.1 mL

ITGAL, ID (ITGAL, CD11A, Integrin alpha-L, CD11 antigen-like family member A, Leukocyte adhesion glycoprotein LFA-1 alpha chain, Leukocyte function-associated molecule 1 alpha chain, CD11a) (MaxLight 650)

Sign In for Pricing
View Details
ITGAL, ID (ITGAL, CD11A, Integrin alpha-L, CD11 antigen-like family member A, Leukocyte adhesion glycoprotein LFA-1 alpha chain, Leukocyte function-associated molecule 1 alpha chain, CD11a) (MaxLight 650)
MBS6311232-02 5x 0.1 mL

ITGAL, ID (ITGAL, CD11A, Integrin alpha-L, CD11 antigen-like family member A, Leukocyte adhesion glycoprotein LFA-1 alpha chain, Leukocyte function-associated molecule 1 alpha chain, CD11a) (MaxLight 650)

Sign In for Pricing
View Details
ARRB2 (Arrestin beta-2, ARB2, ARR2, BARR2, DKFZp686L0365, Beta Arrestin 2) (MaxLight 750)
MBS6407310-01 0.1 mL

ARRB2 (Arrestin beta-2, ARB2, ARR2, BARR2, DKFZp686L0365, Beta Arrestin 2) (MaxLight 750)

Sign In for Pricing
View Details
ARRB2 (Arrestin beta-2, ARB2, ARR2, BARR2, DKFZp686L0365, Beta Arrestin 2) (MaxLight 750)
MBS6407310-02 5x 0.1 mL

ARRB2 (Arrestin beta-2, ARB2, ARR2, BARR2, DKFZp686L0365, Beta Arrestin 2) (MaxLight 750)

Sign In for Pricing
View Details