Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD6 Rabbit Polyclonal Antibody (FITC)

LYPD6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LYPD6, UNQ3023/PRO9821

UniProt

Q86Y78

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LYPD6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYC

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

8kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

katanin p80 (KATNB1) (NM_005886) Human Over-expression Lysate
LY417004 100 µg

katanin p80 (KATNB1) (NM_005886) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-GSX1 Antibody Picoband® Fluoro488 Conjugated
A13105-1-Fluoro488 100 µg/Vial

Anti-GSX1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Rheostats, Sliding Contact, Open Type, Single Tube
1091080/1F 1 Each

Rheostats, Sliding Contact, Open Type, Single Tube

Sign In for Pricing
View Details
Hsp90 alpha Antibody, Clone M10E3R: Alkaline Phosphatase
MBS809357-01 0.1 mg

Hsp90 alpha Antibody, Clone M10E3R: Alkaline Phosphatase

Sign In for Pricing
View Details
Hsp90 alpha Antibody, Clone M10E3R: Alkaline Phosphatase
MBS809357-02 5x 0.1 mg

Hsp90 alpha Antibody, Clone M10E3R: Alkaline Phosphatase

Sign In for Pricing
View Details
THT-49-797-10 Pre-sized Labels for Printers
176312 10000 Roll (10000 Label (s) x 1 Roll)

THT-49-797-10 Pre-sized Labels for Printers

Sign In for Pricing
View Details